SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022561245.1.100974 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022561245.1.100974
Domain Number 1 Region: 40-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_022561245.1.100974
Sequence length 119
Comment glutaredoxin [Vibrio nigripulchritudo]; AA=GCF_001050615.1; RF=na; TAX=1238431; STAX=28173; NAME=Vibrio nigripulchritudo BLFn1; strain=BLFn1; AL=Contig; RT=Major
Sequence
MKLIRWVLGRIILGFNFVFSPKGQERSEAEQQAVNEKTKNLSLYQFDACPFCVKVRRQMK
RQSLDIELRDAKNDATHRQDLENGGGRVKVPCLRIDNNGETTWMYESNDIVAYLQKEFA
Download sequence
Identical sequences U4ED29 U4KCI8
gi|549719093|ref|YP_008641726.1| WP_022561245.1.100974 WP_022561245.1.41471 WP_022561245.1.69985 WP_022561245.1.70175 WP_022561245.1.77049 WP_022561245.1.79392 WP_022561245.1.83433 WP_022561245.1.83782 WP_022561245.1.85604 WP_022561245.1.98144 WP_022561245.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]