SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022561416.1.85604 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022561416.1.85604
Domain Number 1 Region: 29-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.36e-37
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_022561416.1.85604
Sequence length 144
Comment thiol reductase thioredoxin [Vibrio nigripulchritudo]; AA=GCF_001050715.1; RF=na; TAX=1238448; STAX=28173; NAME=Vibrio nigripulchritudo SFn135; strain=SFn135; AL=Contig; RT=Major
Sequence
MSSFNSRCPSCQGVNRVPLERVSDAATCGKCKSHLFDGAPIEGTEQNIDALLQSDQPVVV
DFWAPWCNPCVGFAPVFSEVAQERKGNVRFVKIDTEAQQNLGAKYQIRSIPTVMVFKGGK
RVDVINGALPKSHFDQWLNQALFK
Download sequence
Identical sequences U4KIL3
WP_022561416.1.100974 WP_022561416.1.41471 WP_022561416.1.79392 WP_022561416.1.83433 WP_022561416.1.85604 WP_022561416.1.99411 gi|549719300|ref|YP_008641933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]