SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023084197.1.18547 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023084197.1.18547
Domain Number 1 Region: 248-313
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000288
Family Pseudo ankyrin repeat 0.02
Further Details:      
 
Weak hits

Sequence:  WP_023084197.1.18547
Domain Number - Region: 27-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0824
Family SMI1/KNR4-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023084197.1.18547
Sequence length 417
Comment MULTISPECIES: hypothetical protein [Pseudomonas]; AA=GCF_900146655.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; AL=Contig; RT=Major
Sequence
MELSPAERQLLLAHRLAVFDGCVVYDAQPPVSAEHVQRLAEGLAGPIPEDLLRLWRTCFG
GRLGYDLEVDYDGHRHPFSFSELFYPDSDGYHDLWGWIEHERELAAEAAAEEGRDWNGKL
AYLPFGGFEYLERLYVCVEPGPEHGAVIAWSHGLPPAWAGRLHQDSLTRLADDVGGLFRL
LSFEQDPFDAENACGVADELLEALDALEAAGEPGKALKGRLEVLLRQRILDWRPALADGS
LAAEPRLRQLALAEAAQDGDIDLLQRLRDAGCDFAETLRGRGGVLEACLARGRLEAAGWL
LDQGVAVHQDSLQIGAAHLDALLAERLLRLGAISDPNTVLLALQYGDADAARIMARPLLE
ESPARASALRLALASRAERERSDARRVRSGKMGSNRSPDDYLALAERLERFLAELPG
Download sequence
Identical sequences A0A1S1C9J6
WP_023084197.1.18547 WP_023084197.1.22491 WP_023084197.1.26967 WP_023084197.1.32289 WP_023084197.1.33455 WP_023084197.1.33523 WP_023084197.1.38706 WP_023084197.1.40546 WP_023084197.1.43330 WP_023084197.1.4532 WP_023084197.1.6283 WP_023084197.1.76484 WP_023084197.1.76543 WP_023084197.1.81622 WP_023084197.1.94897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]