SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023536446.1.88774 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023536446.1.88774
Domain Number 1 Region: 173-376
Classification Level Classification E-value
Superfamily Lysozyme-like 8.15e-64
Family Family 19 glycosidase 0.0000125
Further Details:      
 
Domain Number 2 Region: 39-159
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.41e-40
Family Ricin B-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023536446.1.88774
Sequence length 376
Comment endochitinase [Streptomyces niveus]; AA=GCF_001723055.1; RF=na; TAX=193462; STAX=193462; NAME=Streptomyces niveus; strain=NRRL 2466; AL=Scaffold; RT=Major
Sequence
MLSKSGRGLSLVRSAILLAVAALVATLFTAPAAQAADGQITGLAGKCVDVAGANNANGTP
VQLYDCNGSNAQRWSNSGDGTLRALGKCLDVSGNSTADGALVHLWDCTGGANQRWVVSGA
NDIVNPQANKCLDVQDRNSANGARLQIWTCSGQSNQKWNAPSSGGGNPSPGGFVVSESQF
NQMFPGRNGFYSYSGLTAALSAYPAFANTGSDTVKRQEAAAFLANVSHETGGLVHIVEQN
TANYPHYCDASQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGINLLADPWRVQNDAA
VAWKTGLWYWNTQNGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPATVQSRINNYQ
RFTQILGVAPGGNLYC
Download sequence
Identical sequences V6KPM1
WP_023536446.1.10790 WP_023536446.1.88774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]