SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023562831.1.52408 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023562831.1.52408
Domain Number 1 Region: 181-410
Classification Level Classification E-value
Superfamily Lysozyme-like 2.81e-83
Family Chitosanase 0.0000000625
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.9e-37
Family Ricin B-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023562831.1.52408
Sequence length 411
Comment glycosyl hydrolase [Actinoplanes friuliensis]; AA=GCF_000494755.1; RF=representative genome; TAX=1246995; STAX=196914; NAME=Actinoplanes friuliensis DSM 7358; strain=DSM 7358; AL=Complete Genome; RT=Major
Sequence
MTIPRLRKRTIAYALGGVLVPAAAVAYGLMPASAATAGPIKGLGGKCVDIAAASSANGTA
VQLYDCNSTGAQNWTVGNTDNSIKALGKCLDVAAAGTANGTKIQIYDCNGTAAQKWTPSN
GTLVNTGSGKCLDATGNSSANGNQLQIWSCGTGANQKWTLPGGGTTPTTSPTTTAPPSGG
VNLDNPAKKDVAMQIVSAAENSSLNWRAQFSYIEDIGDGRGYTAGIIGFCSGTGDMLELV
QAYTATKPGNVLAKYLPALRNVNNSDSHAGLDPNYTRDWKTAAADPVFQAAQESERDRVY
FNPSVRDGKSDGVRALGQFAYYDASVVHGYEGMRSIRSRALQRAKPPSQGGNETTWLNAF
LDERVIEMKKEAAHDDVTRIDTAQRVFLRNGNLDMNTPLDFSIYGDSYHIG
Download sequence
Identical sequences U5WBH4
WP_023562831.1.52408 gi|556571127|ref|YP_008739552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]