SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024069094.1.99476 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_024069094.1.99476
Domain Number - Region: 29-93,120-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0114
Family SMI1/KNR4-like 0.016
Further Details:      
 
Domain Number - Region: 247-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0165
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024069094.1.99476
Sequence length 408
Comment MULTISPECIES: ankyrin repeat protein [Achromobacter]; AA=GCF_001457475.1; RF=representative genome; TAX=85698; STAX=85698; NAME=Achromobacter xylosoxidans; strain=NCTC10807; AL=Complete Genome; RT=Major
Sequence
MSEHFSDDEIQSLRQHGIALFADRVLIAVQPPMSEARIDEIEAMCAGPLPGALRELWRLT
AGGELAYDLHARMDGNEEALSWSELFYDGSDHYRDLAGWIEHEQECAEEAAGERGEAWDG
KLRYLPIGGFEYCDRIYVCLEPGAQAGGIVAWKQGLPGWTHALQQDGVATIAADLLGAFA
ELCLEEDPEDPDSTGIRLLEYLDERVADHGMPQALADKLTAFYRRALVDWRGPLAAGTLG
RSPRLANLALRHALANDDGALVGQLAAQGMRLDQPLRGSATALDVALMQHAHAAAQALLR
ADAPVSADVLHRFDRQPPAELVAQLLARGARADGLGAARCVACGAPDAARLIVAAGGEGM
GAAYAEARDAMLTRYEEDLRRVRAGKLGHYLGADGLAERIANLRAFSI
Download sequence
Identical sequences A0A0D6HT03
WP_024069094.1.1102 WP_024069094.1.3583 WP_024069094.1.99476 gi|568128370|ref|YP_008925017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]