SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024082404.1.23715 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024082404.1.23715
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily YggU-like 2.22e-30
Family YggU-like 0.0000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024082404.1.23715
Sequence length 98
Comment YggU family protein [Pseudomonas aeruginosa]; AA=GCF_000824485.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=Liverpool Epidemic Strain; AL=Contig; RT=Major
Sequence
MSFYRWDGEDLLLDCHLQPKASRDEFAGLHGERLKIRLTAPPVEGKANAHLLAFLGKAFG
VAKSLVSLESGELNRQKRVRIRHPTRLPEELGIAARPA
Download sequence
Identical sequences gi|568151573|ref|YP_008940520.1| WP_024082404.1.11026 WP_024082404.1.11943 WP_024082404.1.13232 WP_024082404.1.14714 WP_024082404.1.1475 WP_024082404.1.21517 WP_024082404.1.22863 WP_024082404.1.23195 WP_024082404.1.23715 WP_024082404.1.24351 WP_024082404.1.251 WP_024082404.1.25142 WP_024082404.1.27837 WP_024082404.1.31279 WP_024082404.1.32544 WP_024082404.1.33210 WP_024082404.1.34832 WP_024082404.1.35857 WP_024082404.1.3833 WP_024082404.1.38502 WP_024082404.1.39088 WP_024082404.1.43662 WP_024082404.1.45090 WP_024082404.1.45485 WP_024082404.1.45934 WP_024082404.1.46152 WP_024082404.1.47774 WP_024082404.1.52690 WP_024082404.1.56797 WP_024082404.1.59076 WP_024082404.1.60415 WP_024082404.1.60603 WP_024082404.1.61696 WP_024082404.1.62516 WP_024082404.1.62534 WP_024082404.1.62701 WP_024082404.1.65099 WP_024082404.1.66526 WP_024082404.1.67388 WP_024082404.1.67686 WP_024082404.1.68862 WP_024082404.1.72331 WP_024082404.1.73149 WP_024082404.1.7547 WP_024082404.1.78430 WP_024082404.1.84374 WP_024082404.1.86545 WP_024082404.1.87435 WP_024082404.1.91431 WP_024082404.1.92624 WP_024082404.1.92769 WP_024082404.1.95460 WP_024082404.1.9722 WP_024082404.1.99461 WP_024082404.1.99757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]