SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024124379.1.87165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024124379.1.87165
Domain Number 1 Region: 4-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.69e-101
Family GABA-aminotransferase-like 0.00000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024124379.1.87165
Sequence length 391
Comment 8-amino-7-oxononanoate synthase [Thermosynechococcus sp. NK55a]; AA=GCF_000505665.1; RF=na; TAX=1394889; STAX=1394889; NAME=Thermosynechococcus sp. NK55a; strain=NK55; AL=Chromosome; RT=Major
Sequence
MSDPFDWLEPALNTLHRAHWYRQPLLSGAPAAVVSVGEPPRPLINFCSNDYLGLANHPQV
KVAAIAAIQQWGTGATGSRLLSGQRHLHAQLERAIAQWKGTEAALVFSSGTAANLGTIAA
LVDQRDLVLGDAYNHACLKKGAHLSRATFYEYPHNNVAALAQLLETHRSQYRRCLILTDG
VFSMDGDVAPLEEILGLAEAYIAMVLVDDAHGTGVLGTNGAGTLAALGQSSPTIIQMGTL
SKALGSLGGYIAGSQALITYLQHRASTWIYSTGLSPADAAAALAALEQLQTDPSLRQALG
ERIQQLEKGLQALGCPVLPRPLPTPIFCLPAPDPATVLQWGQKLQDAGCWVAAVRPPTVP
FSRLRITLRADHTPGHIEQLLAALAALLKCC
Download sequence
Identical sequences V5V3J1
WP_024124379.1.87165 gi|571027363|ref|YP_008899481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]