SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024125479.1.87165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024125479.1.87165
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 2.75e-26
Family Ribosomal protein L28 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024125479.1.87165
Sequence length 78
Comment 50S ribosomal protein L28 [Thermosynechococcus sp. NK55a]; AA=GCF_000505665.1; RF=na; TAX=1394889; STAX=1394889; NAME=Thermosynechococcus sp. NK55a; strain=NK55; AL=Chromosome; RT=Major
Sequence
MSRVCQLTGKKANNAYAISHSHRRTKKLQEVNLQWKRVWWPEGKRWVRLRLSTKAIKTLE
RKGLSAFAKEAGLNLNKL
Download sequence
Identical sequences V5V6A1
WP_024125479.1.87165 gi|571028487|ref|YP_008900607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]