SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024565037.1.12545 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024565037.1.12545
Domain Number 1 Region: 171-334
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024565037.1.12545
Sequence length 354
Comment SMI1/KNR4 family protein [Elizabethkingia anophelis]; AA=GCF_000495995.1; RF=na; TAX=1338014; STAX=1117645; NAME=Elizabethkingia anophelis NUH1; strain=NUH1; AL=Contig; RT=Major
Sequence
MTRICFTADRFDINGNSIALPLPINELESILGEARVFTGEYNTVYTWPELGIKAYSKERK
LVETVDVVFEPEDYEHSPEKVFTGELLLNGTDIKEYYINNKDKRVKLWDDDPNGAFVFNN
HSLWLDIEDGVFNTVSIEAYTKKGEAKTLESLPLDAGFEDLAVIWNKWIAAIKEYVDEDN
AYYNLTHGITAGQMHETEVQLEVPLPGVLLNFYKVHNVRWNAVTSAFSFSVNGWSYDLLP
FEKIIDEWEEIQDLNDDEVLGAEMKEGYSDNVKAVNYANPKWIPFAEGRNGDYLLIDTDP
SEKGTFGQIIELQNEGWTRSVVASSLEELITQEIEIIKSEGNNRFGFIQENGKF
Download sequence
Identical sequences A0A077ECI9
WP_024565037.1.12545 WP_024565037.1.15723 WP_024565037.1.32871 WP_024565037.1.56507 WP_024565037.1.72953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]