SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024629620.1.63575 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024629620.1.63575
Domain Number 1 Region: 163-311
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.01e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 2 Region: 14-118
Classification Level Classification E-value
Superfamily TPR-like 5.4e-16
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024629620.1.63575
Sequence length 321
Comment MULTISPECIES: cell wall assembly protein [Paenibacillus]; AA=GCF_000499205.1; RF=na; TAX=1395587; STAX=1395587; NAME=Paenibacillus sp. MAEPY2; strain=MAEPY2; AL=Contig; RT=Major
Sequence
MNDELLERLEAWHDQDEFEEIVDAITQVPEEERDYILVNHLGRALNNMERYQEAVEQFLS
VEEEGQNDPLWHYRIGLAYYYLEQYENAREAFEAADRLEPGDEDTQEFLEWIRNKTTEEP
AQESEEEPVETLHSVTEINIEAAPGIHPDSTSFWNDSPANVDQYVLSPPTDEQIESVEEQ
LVFKLPTFYINMMKLHNGGVPYYRYFPVSQAGNDGKIYIEISNILGVGREKAHSLGGEAG
SRLIIEQGGYPEIGVVLSECPSKSEVVMLDYRESGNAGEPEVVHVNKAEGYKITWLAPNV
ETFIRGLVNEEKQPANLEGSL
Download sequence
Identical sequences A0A0A2UAF7
WP_024629620.1.47880 WP_024629620.1.63575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]