SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024719258.1.58996 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_024719258.1.58996
Domain Number - Region: 50-92
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0785
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024719258.1.58996
Sequence length 107
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000949525.1; RF=na; TAX=293387; STAX=293387; NAME=Bacillus altitudinis; strain=DSM 26896; AL=Contig; RT=Major
Sequence
MKKIVVLPFLILLLGIVLTACGTAEQSSGENKTSSSTPQVLEEKAEFIGMADAHTVEVKK
VNTTLSYEFTDNFKDVLNEFKPGDKVEISYFINDNGQKEIQKIEKQK
Download sequence
Identical sequences A0A0B0Q9J2 A0A0Q3WCW4 A0A1K1V6C2 A0A1V9CHF3 W8RM36
WP_024719258.1.101882 WP_024719258.1.15494 WP_024719258.1.16908 WP_024719258.1.30940 WP_024719258.1.45032 WP_024719258.1.51056 WP_024719258.1.51573 WP_024719258.1.58996 WP_024719258.1.638 WP_024719258.1.66404 WP_024719258.1.82925 WP_024719258.1.95003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]