SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024766840.1.51069 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024766840.1.51069
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-41
Family SMI1/KNR4-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_024766840.1.51069
Sequence length 133
Comment MULTISPECIES: cell wall assembly protein [Pseudomonas]; AA=GCF_001672555.2; RF=na; TAX=1843184; STAX=1843184; NAME=Pseudomonas sp. AU11447; strain=AU11447; AL=Contig; RT=Major
Sequence
MEDVIEKLREANEPVPVPLELPDEELLVEIEEALLIGIPSEFREFLLLVSDVVYGRLEPV
TATDPQSHTYLPEVAAVAWANGLPRELIPLCADGDDYYAVAEDGEVILWADGELTEETWD
SVWTWARDVWLDT
Download sequence
Identical sequences A0A0F0DQP1 A0A1B8TNE1 A0A1B8VG64 A0A239IGP6
WP_024766840.1.19225 WP_024766840.1.30168 WP_024766840.1.43510 WP_024766840.1.45794 WP_024766840.1.46737 WP_024766840.1.5044 WP_024766840.1.51069 WP_024766840.1.83882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]