SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024895793.1.22424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024895793.1.22424
Domain Number 1 Region: 95-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-18
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.15e-16
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024895793.1.22424
Sequence length 227
Comment GntR family transcriptional regulator [Ochrobactrum rhizosphaerae]; AA=GCF_000559065.1; RF=na; TAX=1437448; STAX=571254; NAME=Ochrobactrum rhizosphaerae SJY1; strain=SJY1; AL=Contig; RT=Major
Sequence
MEHASVHDKTAKNSATLIDSWGSESLAEQAYRVLERSIVTLELEPGAIVNERSLIELTGM
GRTPIREAIQRLAWEGLVEVRPRSGIAIAQIDPTDFTKVLDAREGVERVLARDAARFGSA
RDYERLKAAADAMRQAIPSEDVSLFLDADKAFDIVLGTAASNPYAARLAAPLQTHSRRFW
FRLRPSTGITGSANAHATLIEAIVSREPERASDTASELMAYLRTLAP
Download sequence
Identical sequences WP_024895793.1.22424 281687.CJA24219 CJA24219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]