SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_025366048.1.78809 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_025366048.1.78809
Domain Number 1 Region: 9-96
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000458
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_025366048.1.78809
Sequence length 258
Comment hypothetical protein [Paenibacillus polymyxa]; AA=GCF_000785455.1; RF=na; TAX=1406; STAX=1406; NAME=Paenibacillus polymyxa; strain=CF05; AL=Chromosome; RT=Major
Sequence
MYWVSTQHTPVAADEMANFEHTHGITLPTPYASFLTQYGPGTYCGLLVIEPPDPQLLQSY
ADYELWTHDDNCPITAQQLGECVVIGSSIDGDFLAVHPQVEGLLWLPRHSEVITMKPLDV
QTPFTDTLEHILRDEFGKTEPFPRYFEPVSLDRTATFLLFNPPDTVKAYDPANPNDPIPN
IAPASIQVLAQRFKQHFDTNLWIENEHTCMAFFQLLGGYVRFNYAYGREVAIIYEPKAIA
LHDEILSFLQKEHCRVVE
Download sequence
Identical sequences A0A0F6ESW6
WP_025366048.1.29540 WP_025366048.1.78809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]