SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_025782138.1.74398 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_025782138.1.74398
Domain Number 1 Region: 215-370
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.95e-42
Family Histidine kinase 0.0007
Further Details:      
 
Domain Number 2 Region: 8-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.92e-22
Family KaiB-like 0.0028
Further Details:      
 
Domain Number 3 Region: 135-206
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_025782138.1.74398
Sequence length 376
Comment ATPase [Candidatus Synechococcus spongiarum]; AA=GCF_000586015.1; RF=na; TAX=1451353; STAX=431041; NAME=Candidatus Synechococcus spongiarum SH4; strain=SH4; AL=Contig; RT=Major
Sequence
MGGPTATNQQASVRVSLLLVASPRHLATRDLRQLTTFLRADHRDLDILLQLVDPRQNPEL
LELHKVVATPALVKLFPTPRQVFTGSTLLSQVRSWLPRWGEIERLNGLAMPVIPSSVEDD
RDSPRVLELEDQLLVLRQENEVLIDRLQFQERQLRMVAHDLRTPMTTTSLALQSFQRGQI
GNGEFLDIISRRIHDMEQLSSDLLEVGSTRWEALFNPQRLSLSQLCADALLELEKMWLGR
NLAVQTDIPTDIPDVFADSRRMRQVLLNLLENAFKFAPDGGHVKLRLMHRTSQWLQVSIC
DNGPGIPVDEQERIFQDQVRLSQTSSRTAGFGVGLSVCRRVVEVHGGKIWVVSELGEGSC
FYFTVPVWRNQKLPGR
Download sequence
Identical sequences WP_025782138.1.74398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]