SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_026502346.1.7203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_026502346.1.7203
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000445
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_026502346.1.7203
Sequence length 261
Comment hypothetical protein [Bifidobacterium boum]; AA=GCF_000687615.1; RF=na; TAX=1410645; STAX=78343; NAME=Bifidobacterium boum DSM 20432; strain=DSM 20432; AL=Scaffold; RT=Major
Sequence
MAYQEVQNLLNEYELLLQHIGIDTAARLAPPISDREIADLEEQYQIRLTQDAKAFWQWHN
GGEPRSAMPGFFQSLSETLATHKEDREIVCESFDHEPDPQEWDECCECQSHNPTGDLTYN
HGARGVVAPFDISLYTAEGFRYCAIFDCGDPDAIDTMTYGVRITDCNQSWVSPEYPKTFA
DRIRNWMTAIRTGVWYPCHLNGQGDTVFLVTCEYQPGGSTTDTYDYESVEFMPSNWQPDM
AEFRPFPGNNPISDEHPAVDE
Download sequence
Identical sequences A0A086ZIK4
WP_026502346.1.16490 WP_026502346.1.46760 WP_026502346.1.7203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]