SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_027472374.1.75972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_027472374.1.75972
Domain Number - Region: 19-40
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0667
Family Proteinase A inhibitor IA3 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_027472374.1.75972
Sequence length 136
Comment hypothetical protein [Saccharicrinis fermentans]; AA=GCF_000517085.1; RF=representative genome; TAX=869213; STAX=982; NAME=Saccharicrinis fermentans DSM 9555 = JCM 21142; strain=DSM 9555; AL=Scaffold; RT=Major
Sequence
MKLLKKLISAGTAETIKEDTKLIDEIFTTKEEKLQGKMELFKMAVADRDSAREMYSNDSW
LQKAFAIFFLIAWCTLTFIMLNNFVFKTIQLEDWQIAFVSSINGGISTKQSTIIDFLFGG
AISSVNNVNLKSKRKA
Download sequence
Identical sequences W7YTM2
WP_027472374.1.27926 WP_027472374.1.75972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]