SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_027589246.1.97745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027589246.1.97745
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-40
Family SMI1/KNR4-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_027589246.1.97745
Sequence length 137
Comment MULTISPECIES: cell wall assembly protein [Pseudomonas]; AA=GCF_000647775.1; RF=na; TAX=1452718; STAX=1452718; NAME=Pseudomonas sp. RL; strain=RL; AL=Contig; RT=Major
Sequence
MEDVIDQLRELNEPVPVPLELPDEETLVEIQEQILIHLPYELREFLLKVSDVVYGRLEPV
TASDPQSHTYLPEVAANAWDAGVPRYLVPLCQDGRDYYAVDPEGEVFLWREDTGELDDET
WESVWHWVRDVWLEGGA
Download sequence
Identical sequences A0A0B3BTA3
WP_027589246.1.20026 WP_027589246.1.32379 WP_027589246.1.60860 WP_027589246.1.6301 WP_027589246.1.97745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]