SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_027882178.1.5876 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027882178.1.5876
Domain Number 1 Region: 217-301
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000471
Family Carboxypeptidase regulatory domain 0.051
Further Details:      
 
Domain Number 2 Region: 311-364
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000706
Family Cna protein B-type domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_027882178.1.5876
Sequence length 386
Comment hypothetical protein [Meiothermus rufus]; AA=GCF_000423425.1; RF=representative genome; TAX=604331; STAX=604332; NAME=Meiothermus rufus DSM 22234; strain=DSM 22234; AL=Scaffold; RT=Major
Sequence
MKPTVLIPIALALFLSGCGFWSTDAPRPNFQVLLVAANLSGSLAQGIPTPDPLGGPKTDL
SQIARVIVNLERIELVGEGGRVVGLAPNPELGDSDGDGRPDIDLMTLSGQPTPLVKGTVP
AGVYTQFRLFSPLEQGAEAQSVYLVMNNGSKVPLRIPSGQQTGLKLVIQGGVRVQVEATT
TLTLAFDLGRSLVQTGNGRYMLKPVVRASGDVSSAMVKGKVTFKGGRAVQDAGVEAKSAD
NTYLTMTNADGLYSFPAVAAPATYAFTFRLQTPENVVYLSKKTLDVPANTVTTVDAEFEP
TGGITVSLKPATPPSDVTVEIKDASQATVASSQEADAQGQYVFSTLPPGLYSVRVGATLG
GTPVSGQATGVVVEDYRMTRLEIELR
Download sequence
Identical sequences WP_027882178.1.5876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]