SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_028413001.1.54970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_028413001.1.54970
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.36e-24
Family SMI1/KNR4-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_028413001.1.54970
Sequence length 147
Comment MULTISPECIES: 1,3-beta-glucan synthase regulator [Bacillus]; AA=GCF_001238505.1; RF=na; TAX=86664; STAX=86664; NAME=Bacillus flexus; strain=Riq5; AL=Contig; RT=Major
Sequence
MKIELLKAVDQELEMYPEAFGGAVTSEEVTQAEAKLKVKLPEDFKKFLLRYGSGAIGEAI
VLGLREAEFVSTPSFVDKSLQFRNMLPQGYEHFVVIGVDSAGNPVGFQYPNKEIIIVDFD
FGGKKVIAGSFEEYLEKSIHEELNIHF
Download sequence
Identical sequences A0A0L1LUI1 A0A2B0S9X4
WP_028413001.1.31602 WP_028413001.1.54970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]