SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_029974608.1.13676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_029974608.1.13676
Domain Number 1 Region: 6-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-34
Family SMI1/KNR4-like 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_029974608.1.13676
Sequence length 154
Comment MULTISPECIES: hypothetical protein [Bacillus amyloliquefaciens group]; AA=GCF_001687195.1; RF=na; TAX=492670; STAX=492670; NAME=Bacillus velezensis; strain=SRCM100730; AL=Contig; RT=Major
Sequence
MDFYLKVREFIADNAKEKDFTGGIGEDKILKIEQDLQVTLPDSYKWFLRNYGSGGVYGID
LLGYDFGGASVVETTREYHEYRGLPSGLVVIEHVDFFGYCLDTNKINSEGECPVVIWSEF
GGYKELNSAHFIKFFYERLHEMKENWEEDEDWDD
Download sequence
Identical sequences A0A0D7XSA3 A0A1D9PKE8 A0A2D3DNR2
WP_029974608.1.10011 WP_029974608.1.13676 WP_029974608.1.18446 WP_029974608.1.62871 WP_029974608.1.80415 WP_029974608.1.8397 WP_029974608.1.93013 WP_029974608.1.95227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]