SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_030337936.1.100162 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_030337936.1.100162
Domain Number 1 Region: 171-401
Classification Level Classification E-value
Superfamily Lysozyme-like 1.63e-84
Family Chitosanase 0.0000000747
Further Details:      
 
Domain Number 2 Region: 37-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.93e-39
Family Ricin B-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_030337936.1.100162
Sequence length 402
Comment glycoside hydrolase [Micromonospora parva]; AA=GCF_000718515.1; RF=na; TAX=1464048; STAX=1464048; NAME=Micromonospora parva; strain=NRRL B-2680; AL=Contig; RT=Major
Sequence
MVHQRTAASVVGALLIGVAAVGYGVTSASAATAGPITGLGGKCIDVAGANPANGTAVQLY
DCNGSAAQTWTVGNTDTSIRALGKCLDVTAASTANGAKVQLYDCNNTGAQKWTASNGALV
NSGSGKCLDVTDRSTANGARLQIWTCGGTTNQRWTLPGGGTPTPTPTNPSGTNLDDPAKK
DVAMQLVSAAENSSLDWRAQFSYIEDIGDGRGYTAGIIGFCSGTGDMLELVEAYTRTKPG
NVLAGYLPALRTVNGTPSHSGLDPNFPRDWRTAATDPVFQAAQEAERDRVYFNPSVRDGK
NDQVRALGQFAYYDAAVMHGYEGMRQIRSRALNRAKPPAQGGDERTWLNAFLDERVIEMK
KEAAHSDTSRVDTAQRVFLNNGNFNLNTPLVFAVYGDQFRIG
Download sequence
Identical sequences WP_030337936.1.100162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]