SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_030926850.1.71386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_030926850.1.71386
Domain Number 1 Region: 178-381
Classification Level Classification E-value
Superfamily Lysozyme-like 1.07e-67
Family Family 19 glycosidase 0.00000934
Further Details:      
 
Domain Number 2 Region: 45-164
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.81e-41
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_030926850.1.71386
Sequence length 381
Comment chitinase [Streptomyces sp. NRRL S-646]; AA=GCF_000720765.1; RF=na; TAX=1463917; STAX=1463917; NAME=Streptomyces sp. NRRL S-646; strain=NRRL S-646; AL=Contig; RT=Major
Sequence
MATPHPRWFRHRRATFQRLTLAAVLAALLTALLNVTPASAADGQITGLAGKCVDVAGANS
ANGTAVQLYDCNGTNAQLWSDPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGGANQQW
VVTGAHDIVNPAANKCLDVRDNNSANGTRLQIWTCSGGANQKWNAPGSGGGGGNPSGFVV
SESQFNQIFPNRNSFYTYSGLTAALAAYPGFATTGSDTVKKQEAAAFLANVSHETGGLVY
VVEQNTANYPTYCDWSRPYGCPAGQAAYYGRGPLQLSWNFNYKAAGDALGIDLLGNPWQV
EQNASVAWKTGLWYWNTQSGPGTMTPHNAMVDSAGFGQTIRSINGSLECDGRNPAQVQSR
VDAYQRITAVLGVAPGNNLYC
Download sequence
Identical sequences WP_030926850.1.71386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]