SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_030984213.1.56730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_030984213.1.56730
Domain Number 1 Region: 163-366
Classification Level Classification E-value
Superfamily Lysozyme-like 1.35e-69
Family Family 19 glycosidase 0.0000104
Further Details:      
 
Domain Number 2 Region: 31-150
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.49e-41
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_030984213.1.56730
Sequence length 366
Comment chitinase [Streptomyces sp. NRRL WC-3744]; AA=GCF_000717895.1; RF=na; TAX=1463935; STAX=1463935; NAME=Streptomyces sp. NRRL WC-3744; strain=NRRL WC-3744; AL=Contig; RT=Major
Sequence
MHLGRTLAGFVAACLAVLFAVTPAQAADGQITGLAGKCVDVAGANSANGTAVQLYDCNGT
NAQRWSNPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGGANQQWVVTAAHDIVNPAAN
KCLDVRDNNSANGTRLQIWSCTGGANQKWNAPASGGGTTPSGFVVSEAQFNQMFPNRNSF
YTYSGLTAALGAYPAFANTGSDTVKKQEAAAFLANVSHETGGLVYVVEQNTANYPHYCDP
NQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALHIDLLNNPWLVQNDPAVAWKTGLWYW
NTQSGPGTMTPHDAMVNGAGFGQTIRSINGSLECDGKNPAQVQSRVDAYLRFTQILGVSP
GGNLYC
Download sequence
Identical sequences WP_030984213.1.24691 WP_030984213.1.56730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]