SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_031048102.1.38480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031048102.1.38480
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 7.31e-67
Family Family 19 glycosidase 0.00000838
Further Details:      
 
Domain Number 2 Region: 34-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.66e-41
Family Ricin B-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_031048102.1.38480
Sequence length 371
Comment MULTISPECIES: chitinase [Streptomyces]; AA=GCF_000721945.1; RF=na; TAX=1463937; STAX=1463937; NAME=Streptomyces sp. NRRL WC-3774; strain=NRRL WC-3774; AL=Scaffold; RT=Major
Sequence
MSSSLRSGRLAVFAVLAAVLTALLTVTPAHAASGTITGLAGKCVDVAGASTANGTAVQLY
DCNGTGAQIWSDSGDGTLRALGKCLDIADRSTADGAAVQLWDCSGGANQQWVVSGARDIV
NPAANKCLDVRDNNSANGTRLQIWTCAGTANQKWNAPASGGGGTPSGFVVSEAQFNQMFP
NRNSFYTYNGLVAALSAYPGFAGTGSDTVRKQEAAAFLANVNHETGGLVHIVEQNTANYP
TYCDWNQSYGCPAGQAAYYGRGPIQLSWNFNYKTAGDALGIDLLNNPWLVQNDSAVAWKT
GLWYWNTQSGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFTSI
LGVSPGGNLYC
Download sequence
Identical sequences A0A101N802
WP_031048102.1.38480 WP_031048102.1.79512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]