SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_032004079.1.59526 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_032004079.1.59526
Domain Number 1 Region: 23-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000916
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_032004079.1.59526
Sequence length 184
Comment hypothetical protein [Acinetobacter sp. 1542444]; AA=GCF_000581835.1; RF=na; TAX=1310681; STAX=1310681; NAME=Acinetobacter sp. 1542444; strain=1542444; AL=Contig; RT=Major
Sequence
MTDFVKELSACRVEGTQLPFYPEKVQGYTEQEVELIAKNLNLDIHGQFRDFLLQIGKCSG
GLLLSDEFYMYDYRCEKYFFINYQKNIQEDDYMFDNQGKLNPVGKKIFFLSCEYETYLYY
LFTSEQDNYVWFLDSAESAIWEKTNMTLLDYLKNYVFEKTKRNRFIDFDLTEEQINRSIT
GRLL
Download sequence
Identical sequences A0A010K7Z2 A0A2I6LVT7
WP_032004079.1.59526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]