SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_032038301.1.60739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_032038301.1.60739
Domain Number 1 Region: 49-170
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000719
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_032038301.1.60739
Sequence length 174
Comment MULTISPECIES: SMI1/KNR4 family protein [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_001617545.1; RF=na; TAX=48296; STAX=48296; NAME=Acinetobacter pittii; strain=IEC338SC; AL=Complete Genome; RT=Major
Sequence
MKLLNEALRKIETLWSKEPKHAVHRGEKTFFQFRCILNNGISPDRFGDIDLQLPTEFKEF
LLVSNGADLFKDEEYGQWGARIFSIDELQSSNKYYRELRPKDFTKGDLIIGEFYGDSDLL
LLRCDPESKDYGAVLIALPFDNRSDWYCSANFENFITDYVNSEGDKFWEIRTKT
Download sequence
Identical sequences A0A013SXY7 A0A143IYE9
WP_032038301.1.21058 WP_032038301.1.40165 WP_032038301.1.60739 WP_032038301.1.62345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]