SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_033343284.1.39202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_033343284.1.39202
Domain Number 1 Region: 169-372
Classification Level Classification E-value
Superfamily Lysozyme-like 3.09e-68
Family Family 19 glycosidase 0.0000116
Further Details:      
 
Domain Number 2 Region: 37-157
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.14e-36
Family Ricin B-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_033343284.1.39202
Sequence length 372
Comment chitinase [Catenuloplanes japonicus]; AA=GCF_000717135.1; RF=representative genome; TAX=33876; STAX=33876; NAME=Catenuloplanes japonicus; strain=NRRL B-16061; AL=Contig; RT=Major
Sequence
MRFPELRRTLLAAALSLTTALGLLAFTGQPASAATGTITGLAGKCIGAAGGNTGNGTAID
LYPCVGDATQQWTRPGDGTIRTAGKCMDVSNAGTADGTKVQIWDCNGSVAQQWVFSGARD
LVNPNANKCLDLNGNSSADFTIVHLWTCTGGANQKWNAPAAGGGNPGGFVVTEAQFNSMF
PGRNSFYTYSGLVAALSAYPGFAGTGSDTVRKQEAAAFLANVNHETGGLVYVVEQNTANY
PHYCDWGQPFGCPAGQAAYYGRGPVQLSWNYNYKAAGDALGIDLLNNPWRVEQDPAVAWK
TGIWFWMTSTGAGSMTSHNAMVNSAGFGQTIRTINGALECDGKRPDAVQARVSAYQRFTG
ILGVTPGANLYC
Download sequence
Identical sequences WP_033343284.1.39202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]