SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_033435885.1.52112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_033435885.1.52112
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000216
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_033435885.1.52112
Sequence length 272
Comment hypothetical protein [Saccharothrix syringae]; AA=GCF_000716755.1; RF=representative genome; TAX=103733; STAX=103733; NAME=Saccharothrix syringae; strain=NRRL B-16468; AL=Contig; RT=Major
Sequence
MTAPRAWRPIAGGPPAGPLVLAVDFAATGRPEAAFADLVARLDPGTEVWESLQPPLGTET
GMVAEDYVTRWEEEVRASGRRIGAVLGFCAGSAFAGELAVRLARSQPRSPRLVVFDPESP
TTSTLYYQFRKVVESLAGVLGEQAAREALAEGTAAADRIGDVEGLGAELVRVFTAAGRAA
CAAADLDDEFADELTATYRSFVSYLVAAAAVDHVKCWSGAVAVSSATPTSGLNPLDPAAR
AALVERELTFDVHHADLLRDPGVARAVARLLA
Download sequence
Identical sequences A0A1X9WEN9
WP_033435885.1.52112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]