SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_033629671.1.15677 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_033629671.1.15677
Domain Number 1 Region: 34-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000432
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_033629671.1.15677
Sequence length 161
Comment 1,3-beta-glucan synthase regulator [Streptococcus oralis]; AA=GCF_000960035.1; RF=na; TAX=1891914; STAX=1303; NAME=Streptococcus oralis subsp. oralis; strain=SK141; AL=Contig; RT=Major
Sequence
MNIKFKKFGLSPEDIQQMKNYGILPDKRTLKSLSKAYNSSNPNIKDIIEFQDKLGFKIDT
DYVDFLLKNNGGVPSKIRIKGNKMVIDHFLSFKSDYKLNSIIDIYPDFQQYGLPIAETPS
GDSIILSSDGKIRFFNHNIDSIDEEIGVIADNFLELLEKLY
Download sequence
Identical sequences A0A0F2DM34
WP_033629671.1.15677 WP_033629671.1.19432 WP_033629671.1.97435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]