SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_034651316.1.94149 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034651316.1.94149
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-35
Family SMI1/KNR4-like 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_034651316.1.94149
Sequence length 148
Comment hypothetical protein [Bacillus megaterium]; AA=GCF_000832985.1; RF=representative genome; TAX=1348623; STAX=1404; NAME=Bacillus megaterium NBRC 15308 = ATCC 14581; strain=ATCC 14581; AL=Complete Genome; RT=Major
Sequence
MNQKEMSEFIQFNSEINDFTGGVSDEIIKEVEKALKVKFPDSYIWFLENYGSGGLFGVDI
LGCGKSATPSVVTNTERFRNIGLPTQYVVVENCEEFVYCLDTENLIDAECVVVSWDRIDG
YSGKRADNFYEFLTNRLLDAKENWDEDF
Download sequence
Identical sequences A0A0B6AKE5
WP_034651316.1.44691 WP_034651316.1.61351 WP_034651316.1.91935 WP_034651316.1.94149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]