SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_035680740.1.23404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_035680740.1.23404
Domain Number 1 Region: 18-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.4e-16
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_035680740.1.23404
Sequence length 209
Comment glucan synthesis regulatory protein [Flavobacterium reichenbachii]; AA=GCF_000737685.1; RF=na; TAX=362418; STAX=362418; NAME=Flavobacterium reichenbachii; strain=LMG 25512; AL=Contig; RT=Major
Sequence
MTVNKVIATFKNKLDIFETLMNKGLKDFEIDDFQKYVKQDLPSEYIELLKNYNGEKHILC
CMAGFGFSNIEQVKINWDSFNNEEQNNRPEKIFQKHKITPLLFSDKRIPFAHDGSGNFLC
IDYIPNFSGKTGQIIYLPQGEPEPISVIADSFNDFLLFLIASIKNESLKLVDEREDWDQE
DWHMADLYFYKTWKNDWTDIADNYNQNHQ
Download sequence
Identical sequences A0A085ZJ44
WP_035680740.1.23404 WP_035680740.1.82313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]