SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_037781922.1.70323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_037781922.1.70323
Domain Number 1 Region: 156-359
Classification Level Classification E-value
Superfamily Lysozyme-like 1.27e-68
Family Family 19 glycosidase 0.00000934
Further Details:      
 
Domain Number 2 Region: 23-143
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-40
Family Ricin B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_037781922.1.70323
Sequence length 359
Comment chitinase [Streptomyces sp. HGB0020]; AA=GCF_000411315.1; RF=na; TAX=1078086; STAX=1078086; NAME=Streptomyces sp. HGB0020; strain=HGB0020; AL=Scaffold; RT=Major
Sequence
MAVLAALLTALVSVTPASATSGQITGLAGKCVDVAGANSANGTAVQLYDCNGTGAQNWSN
PGDGTLRALGKCLDVVDRSTADGAAVQLWDCNGGANQQWVVSGAHDIVNPAANKCLDVRD
NNSANGTRLQIWTCTGGANQKWNAPASGGGGTPSGFVVSESQFNQMFPNRNSFYTYSGLT
AALSAYPGFANTGSDTVKKQEAAAFLANVSHETGGLVYVVEQNTANYPTYCDWSQSYGCP
AGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDSAVAWKTGLWYWNTQSGPG
TMPPHNAMVNGAGFGQTIRSINGSLECDGRNPAQVQSRVDAYQRFTSILGVSPGGNLYC
Download sequence
Identical sequences WP_037781922.1.70323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]