SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_038253394.1.87433 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_038253394.1.87433
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000101
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_038253394.1.87433
Sequence length 176
Comment hypothetical protein [Xenorhabdus bovienii]; AA=GCF_000736535.1; RF=na; TAX=1398202; STAX=40576; NAME=Xenorhabdus bovienii str. oregonense; strain=oregonense; AL=Scaffold; RT=Major
Sequence
MTKTELIEYLHSAYPELTIDTNYIKGYSEEDILKLESLRDFKIQGQLREFLTYMGRCSGG
LFGSQPLKFYPEIVNPKGKEIYQSECRKDLVEIEGEDILNQKPFFISIENEGIYDYFLLT
DSDSPDLVYYIDNNYNTIVDTGLTFNKYLRSVVDSSRSYIYKVPTYQEGDLIKLYS
Download sequence
Identical sequences A0A077P056
WP_038253394.1.87433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]