SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_038589102.1.33837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_038589102.1.33837
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000314
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_038589102.1.33837
Sequence length 154
Comment SMI1/KNR4 family protein [Paenibacillus sp. FSL H7-0357]; AA=GCF_000758525.1; RF=na; TAX=1536774; STAX=1536774; NAME=Paenibacillus sp. FSL H7-0357; strain=FSL H7-0357; AL=Complete Genome; RT=Major
Sequence
MKYLNELVSQFRIDKIPMSPCTNEDLINVRKMISDQTLPMAYIEFLETMGNGTDHTFLRG
ESCFMDELLELNEGGAELLEENNVPLKLTSNDFVFWMSQGCMFCFFKLDEGENPPVYFYS
EGKKKDGFYKITDTFTEFLQRRYIKDRYIFQKKE
Download sequence
Identical sequences A0A089I3N2
WP_038589102.1.33837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]