SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_039424163.1.63325 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_039424163.1.63325
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000275
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_039424163.1.63325
Sequence length 202
Comment SMI1/KNR4 family protein [Porphyromonas gulae]; AA=GCF_000768775.1; RF=na; TAX=111105; STAX=111105; NAME=Porphyromonas gulae; strain=COT-052 OH3439; AL=Contig; RT=Major
Sequence
MKEKELVQKIISHIEEISGGLYILNQSNIKRADFIKYIFDLECYIGCKINPILVEVWNRF
NGCSFNKNIGIKPDDRIPTLGDGELIELTRFFSIESTGDDVLEMLRSNADIFGKEYIPFA
EAIEGDFFVLSSKGNGIYYVLHDFNEDEKCFHKVADTISDFFMAVQLMVATEKIDNEKMR
IVSSSLSSPLLSKLKKFKENNK
Download sequence
Identical sequences A0A0A2GHS5
WP_039424163.1.2267 WP_039424163.1.5346 WP_039424163.1.63325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]