SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_040272431.1.71031 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_040272431.1.71031
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000706
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_040272431.1.71031
Sequence length 147
Comment cell wall assembly protein [Streptomonospora alba]; AA=GCF_000826685.1; RF=representative genome; TAX=183763; STAX=183763; NAME=Streptomonospora alba; strain=YIM 90003; AL=Contig; RT=Major
Sequence
MILGVWRELIVELYPRAELAEPADEAAVALIEKELGLPVPFELASFFGECDGVCNEYGDA
VVWPVRRVVEDNLAMRAEPDYVELYAPFEELIFFGDSDMGPQFAWVHTDYGPGIVVWDHE
TDRRRLVAVSLRDYLVRCLGEGGGWWR
Download sequence
Identical sequences A0A0C2FJ29
WP_040272431.1.71031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]