SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042187973.1.21252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042187973.1.21252
Domain Number 1 Region: 21-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 2 Region: 252-445
Classification Level Classification E-value
Superfamily L domain-like 4.93e-16
Family Internalin LRR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_042187973.1.21252
Sequence length 497
Comment cell wall assembly protein [Paenibacillus sp. FSL H7-0737]; AA=GCF_000758545.1; RF=na; TAX=1536775; STAX=1536775; NAME=Paenibacillus sp. FSL H7-0737; strain=FSL H7-0737; AL=Complete Genome; RT=Major
Sequence
MSLVNEKEECLLIETLKSHIPNVEELLNPAVEESELNLFESMMNCKFPEDFRKLYMNSNG
EGEQIFGVMAGLGWMNIESIVSNWKSLLESAYDIISSKPDIIKDGNYREGWIPFAEDGGG
SYLAIDLDPGEKGVYGQIITIDHNSSFSYVIAESLGHFFEFIDSSLRNSSIGIREEDDVI
ILSRESGSLLDDILALTKMDIEENSLIPVSGFWEEYFKDDVESGFVSSKTLKKKRMVFIR
ADQAQKYGAISLDILTHMVNLKELIIHADEITNFDVLKRLPSLAELVIGSEAFKESDLEY
LVSLDGLRQLTLIGLPLKDIHKLKDIKKLKSLRLYRMNSIDRGLIGTIKNLKELSLEEME
VGDLLYISNLSKLIKLELKQVTIPHLSFLKGLKNLTFFETDSCAIDESHIEVIRELKKLK
QFTYPVGDLTILKNCMSLKQIGVDASRLKGLEEISDCNIVDITIFHATSKENAKSVVAEF
NKYFKLQSYGWQVTWKD
Download sequence
Identical sequences A0A089IHM9
WP_042187973.1.21252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]