SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042189376.1.21252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042189376.1.21252
Domain Number 1 Region: 33-88,138-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000262
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_042189376.1.21252
Sequence length 442
Comment hypothetical protein [Paenibacillus sp. FSL H7-0737]; AA=GCF_000758545.1; RF=na; TAX=1536775; STAX=1536775; NAME=Paenibacillus sp. FSL H7-0737; strain=FSL H7-0737; AL=Complete Genome; RT=Major
Sequence
MLFWKKETQIDRIKNKLEKAMRKDTAFLVFGASSHKYKVYEVLTAKELADWQAKNQVTLP
EPYAQFLTKVGNGGAGPYYGIYSIEKATSYTERNAFTTKCVIHPRMTKEKWNHLIEPLIS
DEDISDPEYDAARDRVMGGMLCIGTQGCEYDMYLVLEGKHRGKIIYTAVFYPDHPFFFVY
EDNFLDWYERWLDEIILDYDIAWFGSRMPGDENALIQVYQNAPNEEIKSKALDGMFKFKK
ISQPTIDFLRSVAEQRQNDRTTSIQLICKTSFDAGRVYLLELLYSERNEDFLQALMILNW
YGKSFDLAEFIKVILQSLDRVHDSETLRHVGYVLESSGAITLQNFASFLCHTDSNIQSAA
IYATRNCNDKSESWEIIEQMLVGGDKEVVKNTILFWGVIPHEKLLRHYKVAWPEYKSNIN
FKEKFTDCLKKLNLPDDYFDKE
Download sequence
Identical sequences A0A089JUN9
WP_042189376.1.21252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]