SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042193876.1.17128 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042193876.1.17128
Domain Number 1 Region: 4-469
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.34e-104
Family Acetylcholinesterase-like 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_042193876.1.17128
Sequence length 471
Comment carboxylesterase [Kibdelosporangium sp. MJ126-NF4]; AA=GCF_000826545.1; RF=na; TAX=703222; STAX=703222; NAME=Kibdelosporangium sp. MJ126-NF4; strain=MJ126-NF4; AL=Scaffold; RT=Major
Sequence
MNTDPTTVDISHGALRGAVAGGVFAYKGIPYAAPPVGPNRFLPPQPVVPWTGTRDATRFG
PTAPKARYAPPLDALIPDADIPGEDYLNLNVYTPDPGGRLPVMVWIHGGAFLNGSGSSYD
GTAFARDGVVCVTVNYRLGADGFLCFPGNANRGLLDQVAALEWVRDNIAAFGGDPSQVTV
FGQSAGAMSVGMLLGMPKAAGLFHRAILQSGATRHVLSPASAELVKARLVAKLGTDDIAA
VPVAELVVAQQQLRGELGANPDPALWGDAAGTMLPFGPVLHDGLAPGSSDVDIMVGTTAE
EFRLYLVPNGMIDLITDKIRDGTFARLGLDPRRAGEVYESSPGEQVSAAMTDWHFRTPAI
RLAEQARTAYMYEFTWQPGTFGGRLGACHAAEIPFVFDTLRDGTFNGLLGTGLPQHLADT
MHTAWVSFAIHGNPGWFAYDTNSRSTMRFDIESEVVLDPDAARRTLWEGIR
Download sequence
Identical sequences A0A0K3BFV4
WP_042193876.1.17128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]