SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042198570.1.17128 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042198570.1.17128
Domain Number 1 Region: 330-492
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000384
Family Fungal lipases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_042198570.1.17128
Sequence length 571
Comment hypothetical protein [Kibdelosporangium sp. MJ126-NF4]; AA=GCF_000826545.1; RF=na; TAX=703222; STAX=703222; NAME=Kibdelosporangium sp. MJ126-NF4; strain=MJ126-NF4; AL=Scaffold; RT=Major
Sequence
MVAYGDVRTWDAEWLHESVGVLNQRCTELVGLSDELGDTANTGRWHGQAAAAATENLSGI
RDGLEDLVSEIAAMRTAMGQVADSVTGLRHGIADAEALASRYYLRIEDNGALTGTTEFGF
SSEDERKQWEQDRERVKAELAERVKEIIRRAEDIDNDLSTVMSKCLDPGGTGNRNQDSLT
EAARAGADAGTLSMLEPPVGGTAASNAAWWATLGEGGKQWILASHPEWIGNLDGVPAHYR
DLANRARIPGERARLRAERDAKAAELRAYEDTPPMSVDPADQRLGRLRTELAAIDAKLDS
LRDVENMLTQPERQLLVLDTTGERAKAAIAVGNVDTANHVAVFTPGMNSTVNDRMEGYDQ
DVEDLRRNALEELRRNGRAGETVATVTWLNYEPPSFDLNPGDAASDSKAREGAARLSSFL
NGIDASRTDDPHLTAIGHSYGSLTTGIALRDNDTGVDDVAVFGSPGLGVNDAAQLKAPTG
HIYNMEADGDRVADAADITKGVSPSQQGWYGRDPAEMPGMRQLSTHDYTAPDGRHFIAAH
GHSEYLRSGDEKYTTSEWNLANVVAGTGITH
Download sequence
Identical sequences A0A0K3BGC0
WP_042198570.1.17128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]