SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042632190.1.6738 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042632190.1.6738
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000235
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_042632190.1.6738
Sequence length 141
Comment cell division protein [Helicobacter pylori]; AA=GCF_000802625.1; RF=na; TAX=210; STAX=210; NAME=Helicobacter pylori; strain=173/00; AL=Scaffold; RT=Major
Sequence
MDRISTETELNWEFVEPLNDNALSRLEERLKIGLSDEFKDFIKRSNYGFSQWRYFMVGNE
SYMFKHVLNFNLEGKGLFVDFMQSLKEWLDPEEIVFANDGYGGYYLWNTTTDVVLFLDTD
NGSKKVLLNLNMFLKKLESRG
Download sequence
Identical sequences A0A0B2ECZ1
WP_042632190.1.6738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]