SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042754532.1.4947 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042754532.1.4947
Domain Number 1 Region: 3-344
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 6.15e-94
Family Pseudo ankyrin repeat 0.0000000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_042754532.1.4947
Sequence length 368
Comment hypothetical protein [Legionella pneumophila]; AA=GCF_900058855.1; RF=na; TAX=446; STAX=446; NAME=Legionella pneumophila; strain=2532STDY5467642; AL=Contig; RT=Major
Sequence
MYNLTIHNLENYEKDPKIRLIPWALWENLFQHFISVYELSLMTLSYKEAIHIFLPKTKNK
EQLRQLLCLYYAHFDRNDKQFWCDVHKKGIKSEVICCAAAITGCSSALDTISLSLIPDEI
VKMIQAENYYAFRLTAENGHLHVLNRLCELAPTEVMAMIQAENYHAFRLAAENGHLHVLN
RLCELAPTEATAMIQAENYYAFRWAAVGRGHHNVINFLLDCPTMLGYAEMHEFEYGEKYV
NPFIVRHVNRLKEMHDAFKQSNPEDLFDLVTKSECLQGFYMLRNLIRRNDEALLDDIRFL
LSIPGIKALAPAGTIPGNENELLRLALRLGNQGACALLLSIPSVLALTKANNYYIDEAWG
RLDLRAVA
Download sequence
Identical sequences A0A193HGE6
WP_042754532.1.101551 WP_042754532.1.10829 WP_042754532.1.11786 WP_042754532.1.12039 WP_042754532.1.17092 WP_042754532.1.17841 WP_042754532.1.17948 WP_042754532.1.21504 WP_042754532.1.21543 WP_042754532.1.23866 WP_042754532.1.25399 WP_042754532.1.25858 WP_042754532.1.27113 WP_042754532.1.27538 WP_042754532.1.28686 WP_042754532.1.28721 WP_042754532.1.2919 WP_042754532.1.30240 WP_042754532.1.3115 WP_042754532.1.33232 WP_042754532.1.34463 WP_042754532.1.35082 WP_042754532.1.36350 WP_042754532.1.37322 WP_042754532.1.37678 WP_042754532.1.38414 WP_042754532.1.39491 WP_042754532.1.40835 WP_042754532.1.42431 WP_042754532.1.47638 WP_042754532.1.4842 WP_042754532.1.48523 WP_042754532.1.4947 WP_042754532.1.50842 WP_042754532.1.54472 WP_042754532.1.55380 WP_042754532.1.57907 WP_042754532.1.59940 WP_042754532.1.6243 WP_042754532.1.62652 WP_042754532.1.64936 WP_042754532.1.66827 WP_042754532.1.67291 WP_042754532.1.67497 WP_042754532.1.696 WP_042754532.1.71674 WP_042754532.1.73575 WP_042754532.1.75285 WP_042754532.1.77106 WP_042754532.1.79384 WP_042754532.1.79852 WP_042754532.1.80284 WP_042754532.1.80464 WP_042754532.1.84310 WP_042754532.1.85821 WP_042754532.1.87029 WP_042754532.1.9248 WP_042754532.1.92599 WP_042754532.1.9284 WP_042754532.1.95895 WP_042754532.1.97848 WP_042754532.1.98916 WP_042754532.1.9955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]