SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043147320.1.86357 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043147320.1.86357
Domain Number 1 Region: 15-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.66e-18
Family SMI1/KNR4-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_043147320.1.86357
Sequence length 199
Comment SMI1/KNR4 family protein [Ruegeria sp. PBVC088]; AA=GCF_001717995.1; RF=na; TAX=1858797; STAX=1858797; NAME=Ruegeria sp. PBVC088; strain=PBVC088; AL=Contig; RT=Major
Sequence
MARIIFGNSVTQDRELASEENVLDLENELGLRLPDDYREYLLSVNGGQFERCRFIMGREF
SEYSVYDVEEMLSLGHGECPLEQVFQVNNYYGLDLKPKDAREFIVIGFVSGGNLLILNLK
SGAVMLFDHDIAERPRRCYFEEVSSGFAEFVDGLVEKTKENSRIGSNLSDKEFEDLLAQF
KLQREEEERRMLKGGDLND
Download sequence
Identical sequences A0A0B3RZI4
WP_043147320.1.86357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]