SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043446554.1.62098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043446554.1.62098
Domain Number 1 Region: 20-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000759
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_043446554.1.62098
Sequence length 199
Comment hypothetical protein [Streptomyces nodosus]; AA=GCF_000819545.1; RF=representative genome; TAX=40318; STAX=40318; NAME=Streptomyces nodosus; strain=ATCC 14899; AL=Chromosome; RT=Major
Sequence
MTDYLPAVMAMLGQAQNRYANPSAWDRLHAELGIRLPTDYQTLVDAYAPIQLNGHLSLPH
PATTRWNLGDWIRDTARAWSEVSWEDLDPDEDPRLLFGLTELSFGTRNGLWPIASTDRGE
TLFLMAADGMLSGILVEDGEGGWAQYEMSFAEWLYRYLVGEDMAGPNTSAFYPGPVQLRR
LPMTADERPERWSGPERGM
Download sequence
Identical sequences A0A0B5DUT8
WP_043446554.1.62098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]