SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043448077.1.62098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043448077.1.62098
Domain Number 1 Region: 165-368
Classification Level Classification E-value
Superfamily Lysozyme-like 8.15e-66
Family Family 19 glycosidase 0.0000116
Further Details:      
 
Domain Number 2 Region: 32-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.1e-39
Family Ricin B-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_043448077.1.62098
Sequence length 368
Comment chitinase [Streptomyces nodosus]; AA=GCF_000819545.1; RF=representative genome; TAX=40318; STAX=40318; NAME=Streptomyces nodosus; strain=ATCC 14899; AL=Chromosome; RT=Major
Sequence
MPLSRLTVGAVLSALLATLFVSAPAQAADGQISGLAGKCVDVAAANSANGTAVQLYDCNG
TDAQRWSNPGDGTLRALGKCLDVVDRSTASGAAVQLWDCTGGANQQWVVTAAHDIVNPAA
DKCLDVRDNNSANSTRLQIWTCTGGANQKWNAPASGGGGGTPSGFVVSEAQFNQMFPNRN
SFYSYNGLVQALSSYPGFAKTGSDTVKKQEAAAFLANVNHETGALVYVVEQNTANYPNYC
DWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDSAVAWRTGLW
YWNTQNGPGSMTPHNAMVNGAGFGQTIRSINGSLECDGRNPAQVQSRVDAYQRFTSILGV
SPGNNLYC
Download sequence
Identical sequences A0A0B5DDE1
WP_043448077.1.62098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]