SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043449149.1.73479 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043449149.1.73479
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000955
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_043449149.1.73479
Sequence length 142
Comment hypothetical protein [Pseudarthrobacter phenanthrenivorans]; AA=GCF_000813845.1; RF=na; TAX=361575; STAX=361575; NAME=Pseudarthrobacter phenanthrenivorans; strain=SWC37; AL=Contig; RT=Major
Sequence
MTDMFLEKFRALVPKYLEDEWQEEDGLTPEELDKALADHQFQIPLVLREFYLALGGCEDL
MEAYHYFWDPEELEVDDEGFLMFLEDEEEQFTWGFRVGDLGVPDPIVYRRNNARGQWKSE
EGTFSEFVFDMFEWAFEDEEEE
Download sequence
Identical sequences A0A0B4ERN2
WP_043449149.1.73479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]