SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043873030.1.55931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_043873030.1.55931
Sequence length 731
Comment hypothetical protein [Legionella massiliensis]; AA=GCF_000756815.1; RF=representative genome; TAX=1034943; STAX=1034943; NAME=Legionella massiliensis; strain=LegA; AL=Contig; RT=Major
Sequence
MKETVSFFFLGTACHHSSYQDALTVFHKAAALNANKPGSKVAVHLFDGVGSDPGELADIH
PTPGRYLYDAVNNLKLKVEDGILESVRDLMQQVTGCLAGDGMDDLLFEATLFLEQLIREN
NGVMPKTVNLHGYSRGADSCVRLANLLDSLYPDVKVNLFLVDHVPGPWRADDPNSYVIPK
NVQRIDAAVMLHENTPCFAPQDRSRYVFTSPHTTKVAIKVYPGGHGQAMLLTPEQETNHV
AKLAHDDFYRFCQETGSLSERDPIPPYKVRHTWTSYSDEPAEVLTKEQRFEYYNEMQESW
LLYSKSSAINPRNVLSNHQHYSQDHRLFVNQEHGELFMELFPNLYQWFYEGIKVDRKRLL
KELAILEHSNSKFYEKFCKVNDIQPDSLLPRPRKRRTYFRRQLGKTLVDDERSFLEQAII
SVTNYETHHNEKNCETIAFAIRRLQAFLEHTAEQDDKYTCLYLKQKIANIVRYLAICDKK
DTYLYRQLSKVCHSFQYIDRIIGVLEGHLKNNRELHLEQQNYIERLIEKLLAIKDDDGLN
YMDKLKVAKSTVNSLSLHLQDPEDYRVLSYNLMSRSLYPINGKYTFPSLLKSLNELNSPG
YSEASIASNIAKKFEAYYLRNMFWDSIHKLLSHIINIPPFFSEKKSDLAQEIYQALHKLD
ENGLGNDLTEVSKVLADRQKKVHEDYRANGKQVLGDFDKIMIEANGQLNMEINAFPFKET
DGDIHRELILA
Download sequence
Identical sequences A0A078KXN2
WP_043873030.1.40536 WP_043873030.1.55931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]