SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_044059172.1.83369 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_044059172.1.83369
Domain Number 1 Region: 15-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-27
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_044059172.1.83369
Sequence length 277
Comment MULTISPECIES: SMI1/KNR4 family protein [Bacillales]; AA=GCF_000227465.1; RF=na; TAX=1052585; STAX=1423; NAME=Bacillus subtilis subsp. spizizenii TU-B-10; strain=TU-B-10; AL=Complete Genome; RT=Major
Sequence
MRLNALKRVDLRIRLKDISEDEIKKVEKKLNLTLPQQYKKLIIQQNGGLINFNAFPTNQE
TSCADDHIEVDHIRGIEKDLGILESEYLIKEWGLPQKLLLIQGDGHNWVAWDYRQTNENP
PVHYFDLELNNDFKIADSFDEFLSKLYTYEDETHEYDNLDFDIHTIDPNDPDAIQKEEVE
KILISKNPLEIHRISLFPIQSLEDLEWILHIIKENSIEIKGDMAFELADVLMSIVSSYTH
QIKSANLRKIVREAAQELGKSKNADTEILLDQFKDFM
Download sequence
Identical sequences A0A0M0L4T1
WP_044059172.1.83369 WP_044059172.1.95507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]